Lineage for d1me5c_ (1me5 C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218588Fold a.152: Antioxidant defence protein AhpD [69117] (1 superfamily)
    multihelical; bundle
  4. 218589Superfamily a.152.1: Antioxidant defence protein AhpD [69118] (1 family) (S)
    duplication: contains two structural repeats of 4-helical motif
  5. 218590Family a.152.1.1: Antioxidant defence protein AhpD [69119] (1 protein)
  6. 218591Protein Antioxidant defence protein AhpD [69120] (1 species)
    a novel enzyme with thioredoxin-like activity
  7. 218592Species Mycobacterium tuberculosis [TaxId:1773] [69121] (4 PDB entries)
  8. 218613Domain d1me5c_: 1me5 C: [79026]
    mutant

Details for d1me5c_

PDB Entry: 1me5 (more details), 2.4 Å

PDB Description: crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant

SCOP Domain Sequences for d1me5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1me5c_ a.152.1.1 (C:) Antioxidant defence protein AhpD {Mycobacterium tuberculosis}
ieklkaalpeyakdiklnlssitrssvldqeqlwgtllasaaatrnpqvladigaeatdh
lsaaarhaalgaaaimgmnnvfyrgrgflegryddlrpglrmniianpgipkanfelwsf
avsaingcsqclvahehtlrtvgvdreaifealkaaaivsgvaqalati

SCOP Domain Coordinates for d1me5c_:

Click to download the PDB-style file with coordinates for d1me5c_.
(The format of our PDB-style files is described here.)

Timeline for d1me5c_: