![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
![]() | Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
![]() | Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
![]() | Protein Ribosomal protein L18e [52084] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries) Uniprot P12733 |
![]() | Domain d1m90p_: 1m90 P: [78854] Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ complexed with aca, cd, cl, k, mg, na, pha, sps |
PDB Entry: 1m90 (more details), 2.8 Å
SCOPe Domain Sequences for d1m90p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m90p_ c.12.1.1 (P:) Ribosomal protein L18e {Haloarcula marismortui [TaxId: 2238]} sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
Timeline for d1m90p_:
![]() Domains from other chains: (mouse over for more information) d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ |