Lineage for d1m90p_ (1m90 P:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240543Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 240544Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 240545Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 240556Protein Ribosomal protein L18e [52084] (1 species)
  7. 240557Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (8 PDB entries)
  8. 240559Domain d1m90p_: 1m90 P: [78854]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
    complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m90p_

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit

SCOP Domain Sequences for d1m90p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m90p_ c.12.1.1 (P:) Ribosomal protein L18e {Archaeon Haloarcula marismortui}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOP Domain Coordinates for d1m90p_:

Click to download the PDB-style file with coordinates for d1m90p_.
(The format of our PDB-style files is described here.)

Timeline for d1m90p_: