SCOPe 2.08: Domain d1m90o_: 1m90 O:

Lineage for d1m90o_ (1m90 O:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein L18 (L18p) [53139] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
   Uniprot P14123

8. Domain d1m90o_: 1m90 O: [78853]
   Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
   complexed with aca, cd, cl, k, mg, na, pha, sps
   has additional insertions and/or extensions that are not grouped together

Details for d1m90o_

PDB Entry: 1m90, 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit

PDB Compounds: (O:) ribosomal protein l18

SCOPe Domain Sequences for d1m90o_:

Sequence; same for both SEQRES and ATOM records:

>d1m90o_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

Timeline for d1m90o_:

• d1m90o_ first appeared in SCOP 1.63
  
• d1m90o_ appears in SCOPe 2.07