| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
| Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
| Protein C-terminal domain of ribosomal protein L2 [50115] (5 species) |
| Species Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries) Uniprot P20276 |
| Domain d1m90c1: 1m90 C:91-237 [78839] Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ complexed with aca, cd, cl, k, mg, na, pha, sps |
PDB Entry: 1m90 (more details), 2.8 Å
SCOPe Domain Sequences for d1m90c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m90c1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg
Timeline for d1m90c1:
View in 3DDomains from other chains: (mouse over for more information) d1m901_, d1m902_, d1m903_, d1m904_, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ |