Lineage for d1m90c1 (1m90 C:91-237)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393545Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2393715Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 2393716Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 2393754Species Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
    Uniprot P20276
  8. 2393772Domain d1m90c1: 1m90 C:91-237 [78839]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
    complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m90c1

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
PDB Compounds: (C:) ribosomal protein l2

SCOPe Domain Sequences for d1m90c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m90c1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOPe Domain Coordinates for d1m90c1:

Click to download the PDB-style file with coordinates for d1m90c1.
(The format of our PDB-style files is described here.)

Timeline for d1m90c1: