![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
![]() | Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) ![]() automatically mapped to Pfam PF00238 |
![]() | Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
![]() | Protein Ribosomal protein L14 [50195] (5 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries) Uniprot P22450 |
![]() | Domain d1m90l_: 1m90 L: [78850] Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ complexed with aca, cd, cl, k, mg, na, pha, sps |
PDB Entry: 1m90 (more details), 2.8 Å
SCOPe Domain Sequences for d1m90l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m90l_ b.39.1.1 (L:) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]} mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr fgsvasaatmiv
Timeline for d1m90l_:
![]() Domains from other chains: (mouse over for more information) d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ |