| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class sigma GST [81351] (5 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [81771] (1 PDB entry) |
| Domain d1m0ua1: 1m0u A:123-249 [78359] Other proteins in same PDB: d1m0ua2, d1m0ub2 complexed with gsw, so4 |
PDB Entry: 1m0u (more details), 1.75 Å
SCOPe Domain Sequences for d1m0ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lcgatpwedlqidivvdtindfrlkiavvsyepedeikekklvtlnaevipfylekleqt
vkdndghlalgkltwadvyfagitdymnymvkrdllepypalrgvvdavnalepikawie
krpvtev
Timeline for d1m0ua1: