| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
| Protein Class sigma GST [81362] (5 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [82427] (1 PDB entry) |
| Domain d1m0ua2: 1m0u A:47-122 [78360] Other proteins in same PDB: d1m0ua1, d1m0ub1 complexed with gsw, so4 |
PDB Entry: 1m0u (more details), 1.75 Å
SCOPe Domain Sequences for d1m0ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khsytlfyfnvkalaeplrylfaygnqeyedvrvtrdewpalkptmpmgqmpvlevdgkr
vhqsismarflaktvg
Timeline for d1m0ua2: