Lineage for d1m0ub2 (1m0u B:47-122)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992723Protein Class sigma GST [81362] (5 species)
  7. 992724Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [82427] (1 PDB entry)
  8. 992726Domain d1m0ub2: 1m0u B:47-122 [78362]
    Other proteins in same PDB: d1m0ua1, d1m0ub1
    complexed with gsw, so4

Details for d1m0ub2

PDB Entry: 1m0u (more details), 1.75 Å

PDB Description: Crystal Structure of the Drosophila Glutathione S-transferase-2 in Complex with Glutathione
PDB Compounds: (B:) GST2 gene product

SCOPe Domain Sequences for d1m0ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0ub2 c.47.1.5 (B:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khsytlfyfnvkalaeplrylfaygnqeyedvrvtrdewpalkptmpmgqmpvlevdgkr
vhqsismarflaktvg

SCOPe Domain Coordinates for d1m0ub2:

Click to download the PDB-style file with coordinates for d1m0ub2.
(The format of our PDB-style files is described here.)

Timeline for d1m0ub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m0ub1