Lineage for d1lnwg_ (1lnw G:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351986Family a.4.5.28: MarR-like transcriptional regulators [63379] (8 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 351990Protein MexR repressor [81686] (1 species)
  7. 351991Species Pseudomonas aeruginosa [TaxId:287] [81687] (1 PDB entry)
  8. 351998Domain d1lnwg_: 1lnw G: [78110]

Details for d1lnwg_

PDB Entry: 1lnw (more details), 2.1 Å

PDB Description: crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa

SCOP Domain Sequences for d1lnwg_:

Sequence, based on SEQRES records: (download)

>d1lnwg_ a.4.5.28 (G:) MexR repressor {Pseudomonas aeruginosa}
pvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqmcr
dkalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelfapl
tpveqatlvhlldqclaa

Sequence, based on observed residues (ATOM records): (download)

>d1lnwg_ a.4.5.28 (G:) MexR repressor {Pseudomonas aeruginosa}
pvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrqmcr
dkalitrkirelegrnlvrrernrsfqlfltdeglaihqhaeaimsrvhdelfapltpve
qatlvhlldqclaa

SCOP Domain Coordinates for d1lnwg_:

Click to download the PDB-style file with coordinates for d1lnwg_.
(The format of our PDB-style files is described here.)

Timeline for d1lnwg_: