![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.28: MarR-like transcriptional regulators [63379] (8 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein MexR repressor [81686] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [81687] (1 PDB entry) |
![]() | Domain d1lnwh_: 1lnw H: [78111] complexed with mse |
PDB Entry: 1lnw (more details), 2.1 Å
SCOP Domain Sequences for d1lnwh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnwh_ a.4.5.28 (H:) MexR repressor {Pseudomonas aeruginosa} mnypvnpdlmpalmavfqhvrtriqseldcqrldltppdvhvlklideqrglnlqdlgrq mcrdkalitrkirelegrnlvrrernpsdqrsfqlfltdeglaihqhaeaimsrvhdelf apltpveqatlvhlldqcla
Timeline for d1lnwh_: