Lineage for d1jqbc2 (1jqb C:3140-3313)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841248Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 2841249Species Clostridium beijerinckii [TaxId:1520] [51743] (4 PDB entries)
  8. 2841252Domain d1jqbc2: 1jqb C:3140-3313 [77156]
    Other proteins in same PDB: d1jqba1, d1jqbb1, d1jqbc1, d1jqbd1
    complexed with zn; mutant

Details for d1jqbc2

PDB Entry: 1jqb (more details), 1.97 Å

PDB Description: alcohol dehydrogenase from clostridium beijerinckii: crystal structure of mutant with enhanced thermal stability
PDB Compounds: (C:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1jqbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqbc2 c.2.1.1 (C:3140-3313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mplenavmitdmmttgfhgaeladiemgssvvvigigavglmgiagaklrgagriigvgs
rpicveaakfygatdilnyknghiedqvmkltngkgvdrvimagggsetlsqavkmvkpg
giisninyhgsgdalliprvewgcgmahktikgglcpggrlraerlrdmvvynr

SCOPe Domain Coordinates for d1jqbc2:

Click to download the PDB-style file with coordinates for d1jqbc2.
(The format of our PDB-style files is described here.)

Timeline for d1jqbc2: