Lineage for d1jqba1 (1jqb A:1001-1139,A:1314-1351)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785727Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 2785728Species Clostridium beijerinckii [TaxId:1520] [50143] (4 PDB entries)
  8. 2785729Domain d1jqba1: 1jqb A:1001-1139,A:1314-1351 [77151]
    Other proteins in same PDB: d1jqba2, d1jqbb2, d1jqbc2, d1jqbd2
    complexed with zn; mutant

Details for d1jqba1

PDB Entry: 1jqb (more details), 1.97 Å

PDB Description: alcohol dehydrogenase from clostridium beijerinckii: crystal structure of mutant with enhanced thermal stability
PDB Compounds: (A:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1jqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdXvdlsklvthvyhgfdhieealllmkdkpkdlikavvil

SCOPe Domain Coordinates for d1jqba1:

Click to download the PDB-style file with coordinates for d1jqba1.
(The format of our PDB-style files is described here.)

Timeline for d1jqba1: