Lineage for d1ixda1 (1ixd A:8-98)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055409Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2055410Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2055426Protein Cylindromatosis tumour-suppressor Cyld [82065] (1 species)
  7. 2055427Species Human (Homo sapiens) [TaxId:9606] [82066] (3 PDB entries)
    Uniprot Q9NQC7 125-206, 228-304, 460-550
  8. 2055429Domain d1ixda1: 1ixd A:8-98 [76907]
    Other proteins in same PDB: d1ixda2, d1ixda3
    3rd CAP-Gly domain

Details for d1ixda1

PDB Entry: 1ixd (more details)

PDB Description: solution structure of the cap-gly domain from human cylindromatosis tomour-suppressor cyld
PDB Compounds: (A:) Cylindromatosis tumour-suppressor CYLD

SCOPe Domain Sequences for d1ixda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixda1 b.34.10.1 (A:8-98) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]}
lamppgnshglevgslaevkenppfygvirwigqppglnevlagleledecagctdgtfr
gtryftcalkkalfvklkscrpdsrfaslqp

SCOPe Domain Coordinates for d1ixda1:

Click to download the PDB-style file with coordinates for d1ixda1.
(The format of our PDB-style files is described here.)

Timeline for d1ixda1: