SCOPe 2.05: Domain d1ixda_: 1ixd A:

Lineage for d1ixda_ (1ixd A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.10: Cap-Gly domain [74924] (2 families)

5. Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
   Pfam PF01302

6. Protein Cylindromatosis tumour-suppressor Cyld [82065] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82066] (3 PDB entries)
   Uniprot Q9NQC7 125-206, 228-304, 460-550

8. Domain d1ixda_: 1ixd A: [76907]
   3rd CAP-Gly domain

Details for d1ixda_

PDB Entry: 1ixd

PDB Description: solution structure of the cap-gly domain from human cylindromatosis tomour-suppressor cyld

PDB Compounds: (A:) Cylindromatosis tumour-suppressor CYLD

SCOPe Domain Sequences for d1ixda_:

Sequence; same for both SEQRES and ATOM records:

>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]}
gssgssglamppgnshglevgslaevkenppfygvirwigqppglnevlagleledecag
ctdgtfrgtryftcalkkalfvklkscrpdsrfaslqpsgpssg

Timeline for d1ixda_:

• d1ixda_ first appeared in SCOP 1.63
  
• d1ixda_ appears in SCOPe 2.04
  
• d1ixda_ is called d1ixda1 in SCOPe 2.06
  
• d1ixda_ appears in the current release, SCOPe 2.08, called d1ixda1