Lineage for d1ixda_ (1ixd A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227976Superfamily b.34.10: Cap-Gly domain [74924] (1 family) (S)
  5. 227977Family b.34.10.1: Cap-Gly domain [74925] (2 proteins)
  6. 227978Protein Cylindromatosis tumour-suppressor Cyld [82065] (1 species)
  7. 227979Species Human (Homo sapiens) [TaxId:9606] [82066] (1 PDB entry)
  8. 227980Domain d1ixda_: 1ixd A: [76907]
    structural genomics protein

Details for d1ixda_

PDB Entry: 1ixd (more details)

PDB Description: solution structure of the cap-gly domain from human cylindromatosis tomour-suppressor cyld

SCOP Domain Sequences for d1ixda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens)}
gssgssglamppgnshglevgslaevkenppfygvirwigqppglnevlagleledecag
ctdgtfrgtryftcalkkalfvklkscrpdsrfaslqpsgpssg

SCOP Domain Coordinates for d1ixda_:

Click to download the PDB-style file with coordinates for d1ixda_.
(The format of our PDB-style files is described here.)

Timeline for d1ixda_: