| Class b: All beta proteins [48724] (119 folds) |
| Fold b.34: SH3-like barrel [50036] (12 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (1 family) ![]() |
| Family b.34.10.1: Cap-Gly domain [74925] (2 proteins) |
| Protein Cylindromatosis tumour-suppressor Cyld [82065] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82066] (1 PDB entry) |
| Domain d1ixda_: 1ixd A: [76907] structural genomics protein |
PDB Entry: 1ixd (more details)
SCOP Domain Sequences for d1ixda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens)}
gssgssglamppgnshglevgslaevkenppfygvirwigqppglnevlagleledecag
ctdgtfrgtryftcalkkalfvklkscrpdsrfaslqpsgpssg
Timeline for d1ixda_: