PDB entry 1ixd

View 1ixd on RCSB PDB site
Description: solution structure of the cap-gly domain from human cylindromatosis tomour-suppressor cyld
Deposited on 2002-06-19, released 2002-12-19
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-19, with a file datestamp of 2002-12-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1ixda_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ixdA (A:)
  gssgssglamppgnshglevgslaevkenppfygvirwigqppglnevlagleledecag
  ctdgtfrgtryftcalkkalfvklkscrpdsrfaslqpsgpssg