Lineage for d1ivoc_ (1ivo C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031305Protein Epidermal growth factor, EGF [57215] (2 species)
  7. 3031306Species Human (Homo sapiens) [TaxId:9606] [69939] (5 PDB entries)
  8. 3031310Domain d1ivoc_: 1ivo C: [76853]
    Other proteins in same PDB: d1ivoa1, d1ivoa2, d1ivoa3, d1ivoa4, d1ivoa5, d1ivob1, d1ivob2, d1ivob3, d1ivob4, d1ivob5
    complexed with EGF receptor
    complexed with nag

Details for d1ivoc_

PDB Entry: 1ivo (more details), 3.3 Å

PDB Description: crystal structure of the complex of human epidermal growth factor and receptor extracellular domains.
PDB Compounds: (C:) epidermal growth factor

SCOPe Domain Sequences for d1ivoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivoc_ g.3.11.1 (C:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}
ecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe

SCOPe Domain Coordinates for d1ivoc_:

Click to download the PDB-style file with coordinates for d1ivoc_.
(The format of our PDB-style files is described here.)

Timeline for d1ivoc_: