Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Epidermal growth factor, EGF [57215] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69939] (5 PDB entries) |
Domain d1ivoc_: 1ivo C: [76853] Other proteins in same PDB: d1ivoa1, d1ivoa2, d1ivoa3, d1ivoa4, d1ivoa5, d1ivob1, d1ivob2, d1ivob3, d1ivob4, d1ivob5 complexed with EGF receptor complexed with nag |
PDB Entry: 1ivo (more details), 3.3 Å
SCOPe Domain Sequences for d1ivoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivoc_ g.3.11.1 (C:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} ecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe
Timeline for d1ivoc_: