![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) ![]() |
![]() | Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 |
![]() | Protein EGF receptor Cys-rich domains [82887] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82888] (6 PDB entries) |
![]() | Domain d1ivob3: 1ivo B:163-311 [76851] Other proteins in same PDB: d1ivoa1, d1ivoa2, d1ivoa5, d1ivob1, d1ivob2, d1ivob5, d1ivoc_, d1ivod_ complexed with EGF complexed with nag |
PDB Entry: 1ivo (more details), 3.3 Å
SCOPe Domain Sequences for d1ivob3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivob3 g.3.9.1 (B:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs cvracgadsyemeedgvrkckkcegpcrk
Timeline for d1ivob3: