Lineage for d1h2ua1 (1h2u A:26-290)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725861Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 2725862Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
    contains three domains of this fold connected with long linkers
  7. 2725863Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)
  8. 2725882Domain d1h2ua1: 1h2u A:26-290 [76584]
    Other proteins in same PDB: d1h2ux_, d1h2uy_
    protein/RNA complex; complexed with 7mg, gdp

Details for d1h2ua1

PDB Entry: 1h2u (more details), 2.4 Å

PDB Description: structure of the human nuclear cap-binding-complex (cbc) in complex with a cap analogue m7gpppg
PDB Compounds: (A:) 80 kda nuclear cap binding protein

SCOPe Domain Sequences for d1h2ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2ua1 a.118.1.14 (A:26-290) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
etedhleslickvgeksacslesnleglagvleadlpnykskilrllctvarllpeklti
yttlvgllnarnynfggefveamirqlkeslkannyneavylvrflsdlvnchviaapsm
vamfenfvsvtqeedvpqvrrdwyvyaflsslpwvgkelyekkdaemdrifantesylkr
rqkthvpmlqvwtadkphpqeeyldclwaqiqklkkdrwqerhilrpylafdsilcealq
hnlppftppphtedsvypmprvifr

SCOPe Domain Coordinates for d1h2ua1:

Click to download the PDB-style file with coordinates for d1h2ua1.
(The format of our PDB-style files is described here.)

Timeline for d1h2ua1: