| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) ![]() |
| Family a.118.1.14: MIF4G domain-like [100908] (6 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
| Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species) contains three domains of this fold connected with long linkers |
| Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries) |
| Domain d1h2ua1: 1h2u A:26-290 [76584] Other proteins in same PDB: d1h2ux_, d1h2uy_ protein/RNA complex; complexed with 7mg, gdp |
PDB Entry: 1h2u (more details), 2.4 Å
SCOPe Domain Sequences for d1h2ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h2ua1 a.118.1.14 (A:26-290) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
etedhleslickvgeksacslesnleglagvleadlpnykskilrllctvarllpeklti
yttlvgllnarnynfggefveamirqlkeslkannyneavylvrflsdlvnchviaapsm
vamfenfvsvtqeedvpqvrrdwyvyaflsslpwvgkelyekkdaemdrifantesylkr
rqkthvpmlqvwtadkphpqeeyldclwaqiqklkkdrwqerhilrpylafdsilcealq
hnlppftppphtedsvypmprvifr
Timeline for d1h2ua1: