| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
| Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries) |
| Domain d1h15e2: 1h15 E:2-92 [76461] Other proteins in same PDB: d1h15a1, d1h15a2, d1h15b1, d1h15d1, d1h15d2, d1h15e1 complexed with a peptide from Epstein barr virus DNA polymerase, chains C and H protein/DNA complex; complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1h15 (more details), 3.1 Å
SCOPe Domain Sequences for d1h15e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h15e2 d.19.1.1 (E:2-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
nsqkdfledrraavdtycrhnygvgesftvq
Timeline for d1h15e2: