Lineage for d1h15e2 (1h15 E:2-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938377Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)
  8. 2938408Domain d1h15e2: 1h15 E:2-92 [76461]
    Other proteins in same PDB: d1h15a1, d1h15a2, d1h15b1, d1h15d1, d1h15d2, d1h15e1
    complexed with a peptide from Epstein barr virus DNA polymerase, chains C and H
    protein/DNA complex; complexed with nag

    fragment; missing more than one-third of the common structure and/or sequence

Details for d1h15e2

PDB Entry: 1h15 (more details), 3.1 Å

PDB Description: x-ray crystal structure of hla-dra1*0101/drb5*0101 complexed with a peptide from epstein barr virus dna polymerase
PDB Compounds: (E:) hla class II histocompatibility antigen, dr beta 1 chain

SCOPe Domain Sequences for d1h15e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h15e2 d.19.1.1 (E:2-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
nsqkdfledrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1h15e2:

Click to download the PDB-style file with coordinates for d1h15e2.
(The format of our PDB-style files is described here.)

Timeline for d1h15e2: