![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries) Uniprot P01903 28-207 |
![]() | Domain d1h15a2: 1h15 A:3-81 [76455] Other proteins in same PDB: d1h15a1, d1h15b1, d1h15b2, d1h15d1, d1h15e1, d1h15e2 complexed with a peptide from epstein barr virus dna polymerase, chains C and H protein/DNA complex; complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1h15 (more details), 3.1 Å
SCOPe Domain Sequences for d1h15a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h15a2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d1h15a2: