SCOPe 2.02: Domain d1gqot_: 1gqo T:

Lineage for d1gqot_ (1gqo T:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)

6. Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)

7. Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry)

8. Domain d1gqot_: 1gqo T: [76314]
   complexed with gol

Details for d1gqot_

PDB Entry: 1gqo, 2.1 Å

PDB Description: type ii dehydroquinase from bacillus subtilis

PDB Compounds: (T:) dehydroquinase

SCOPe Domain Sequences for d1gqot_:

Sequence; same for both SEQRES and ATOM records:

>d1gqot_ c.23.13.1 (T:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis [TaxId: 1423]}
phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai
heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak
gqivglgaegyklavryllsqq

Timeline for d1gqot_:

• d1gqot_ first appeared in SCOP 1.63
  
• d1gqot_ appears in SCOPe 2.01
  
• d1gqot_ appears in SCOPe 2.03
  
• d1gqot_ appears in the current release, SCOPe 2.08