Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) |
Protein Type II 3-dehydroquinate dehydratase [52306] (5 species) |
Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry) |
Domain d1gqos_: 1gqo S: [76313] complexed with gol |
PDB Entry: 1gqo (more details), 2.1 Å
SCOPe Domain Sequences for d1gqos_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqos_ c.23.13.1 (S:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis [TaxId: 1423]} phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak gqivglgaegyklavryllsqq
Timeline for d1gqos_: