Lineage for d1gqoa_ (1gqo A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1159436Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1159437Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
  6. 1159438Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)
  7. 1159452Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry)
  8. 1159453Domain d1gqoa_: 1gqo A: [76295]
    complexed with gol

Details for d1gqoa_

PDB Entry: 1gqo (more details), 2.1 Å

PDB Description: type ii dehydroquinase from bacillus subtilis
PDB Compounds: (A:) dehydroquinase

SCOPe Domain Sequences for d1gqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqoa_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis [TaxId: 1423]}
phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai
heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak
gqivglgaegyklavryllsqq

SCOPe Domain Coordinates for d1gqoa_:

Click to download the PDB-style file with coordinates for d1gqoa_.
(The format of our PDB-style files is described here.)

Timeline for d1gqoa_: