Lineage for d1gqot_ (1gqo T:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1357747Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1357748Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 1357749Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 1357763Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry)
  8. 1357783Domain d1gqot_: 1gqo T: [76314]
    complexed with gol

Details for d1gqot_

PDB Entry: 1gqo (more details), 2.1 Å

PDB Description: type ii dehydroquinase from bacillus subtilis
PDB Compounds: (T:) dehydroquinase

SCOPe Domain Sequences for d1gqot_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqot_ c.23.13.1 (T:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis [TaxId: 1423]}
phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai
heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak
gqivglgaegyklavryllsqq

SCOPe Domain Coordinates for d1gqot_:

Click to download the PDB-style file with coordinates for d1gqot_.
(The format of our PDB-style files is described here.)

Timeline for d1gqot_: