Lineage for d1f76a_ (1f76 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2827891Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2827892Species Escherichia coli [TaxId:562] [82239] (1 PDB entry)
  8. 2827893Domain d1f76a_: 1f76 A: [76160]
    complexed with fmn, fmt, oro
    has additional subdomain(s) that are not in the common domain
    has additional insertions and/or extensions that are not grouped together

Details for d1f76a_

PDB Entry: 1f76 (more details), 2.5 Å

PDB Description: escherichia coli dihydroorotate dehydrogenase
PDB Compounds: (A:) Dihydroorotate dehydrogenase (quinone)

SCOPe Domain Sequences for d1f76a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]}
myypfvrkalfqldperaheftfqqlrritgtpfealvrqkvpakpvncmgltfknplgl
aagldkdgecidalgamgfgsieigtvtprpqpgndkprlfrlvdaeglinrmgfnnlgv
dnlvenvkkahydgvlginigknkdtpveqgkddylicmekiyayagyiainisspntpg
lrtlqygealddlltaiknkqndlqamhhkyvpiavkiapdlseeeliqvadslvrhnid
gviatnttldrslvqgmkncdqtgglsgrplqlksteiirrlslelngrlpiigvggids
viaarekiaagaslvqiysgfifkgpplikeivthi

SCOPe Domain Coordinates for d1f76a_:

Click to download the PDB-style file with coordinates for d1f76a_.
(The format of our PDB-style files is described here.)

Timeline for d1f76a_: