Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein Dihydroorotate dehydrogenase [51397] (8 species) |
Species Escherichia coli [TaxId:562] [82239] (1 PDB entry) |
Domain d1f76b_: 1f76 B: [76161] complexed with fmn, fmt, oro has additional subdomain(s) that are not in the common domain has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1f76 (more details), 2.5 Å
SCOPe Domain Sequences for d1f76b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f76b_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} myypfvrkalfqldperaheftfqqlrritgtpfealvrqkvpakpvncmgltfknplgl aagldkdgecidalgamgfgsieigtvtprpqpgndkprlfrlvdaeglinrmgfnnlgv dnlvenvkkahydgvlginigknkdtpveqgkddylicmekiyayagyiainisspntpg lrtlqygealddlltaiknkqndlqamhhkyvpiavkiapdlseeeliqvadslvrhnid gviatnttldrslvqgmkncdqtgglsgrplqlksteiirrlslelngrlpiigvggids viaarekiaagaslvqiysgfifkgpplikeivthi
Timeline for d1f76b_: