PDB entry 1f76

View 1f76 on RCSB PDB site
Description: escherichia coli dihydroorotate dehydrogenase
Class: oxidoreductase
Keywords: monomer, alpha-beta-barrel, fmn binding domain, orotate complex, oxidoreductase
Deposited on 2000-06-26, released 2002-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.177
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (quinone)
    Species: Escherichia coli [TaxId:83333]
    Gene: pyrD, b0945, JW0928
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f76a_
  • Chain 'B':
    Compound: Dihydroorotate dehydrogenase (quinone)
    Species: Escherichia coli [TaxId:83333]
    Gene: pyrD, b0945, JW0928
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f76b_
  • Chain 'D':
    Compound: Dihydroorotate dehydrogenase (quinone)
    Species: Escherichia coli [TaxId:83333]
    Gene: pyrD, b0945, JW0928
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f76d_
  • Chain 'E':
    Compound: Dihydroorotate dehydrogenase (quinone)
    Species: Escherichia coli [TaxId:83333]
    Gene: pyrD, b0945, JW0928
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f76e_
  • Heterogens: FMN, ORO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f76A (A:)
    myypfvrkalfqldperaheftfqqlrritgtpfealvrqkvpakpvncmgltfknplgl
    aagldkdgecidalgamgfgsieigtvtprpqpgndkprlfrlvdaeglinrmgfnnlgv
    dnlvenvkkahydgvlginigknkdtpveqgkddylicmekiyayagyiainisspntpg
    lrtlqygealddlltaiknkqndlqamhhkyvpiavkiapdlseeeliqvadslvrhnid
    gviatnttldrslvqgmkncdqtgglsgrplqlksteiirrlslelngrlpiigvggids
    viaarekiaagaslvqiysgfifkgpplikeivthi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f76B (B:)
    myypfvrkalfqldperaheftfqqlrritgtpfealvrqkvpakpvncmgltfknplgl
    aagldkdgecidalgamgfgsieigtvtprpqpgndkprlfrlvdaeglinrmgfnnlgv
    dnlvenvkkahydgvlginigknkdtpveqgkddylicmekiyayagyiainisspntpg
    lrtlqygealddlltaiknkqndlqamhhkyvpiavkiapdlseeeliqvadslvrhnid
    gviatnttldrslvqgmkncdqtgglsgrplqlksteiirrlslelngrlpiigvggids
    viaarekiaagaslvqiysgfifkgpplikeivthi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f76D (D:)
    myypfvrkalfqldperaheftfqqlrritgtpfealvrqkvpakpvncmgltfknplgl
    aagldkdgecidalgamgfgsieigtvtprpqpgndkprlfrlvdaeglinrmgfnnlgv
    dnlvenvkkahydgvlginigknkdtpveqgkddylicmekiyayagyiainisspntpg
    lrtlqygealddlltaiknkqndlqamhhkyvpiavkiapdlseeeliqvadslvrhnid
    gviatnttldrslvqgmkncdqtgglsgrplqlksteiirrlslelngrlpiigvggids
    viaarekiaagaslvqiysgfifkgpplikeivthi
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f76E (E:)
    myypfvrkalfqldperaheftfqqlrritgtpfealvrqkvpakpvncmgltfknplgl
    aagldkdgecidalgamgfgsieigtvtprpqpgndkprlfrlvdaeglinrmgfnnlgv
    dnlvenvkkahydgvlginigknkdtpveqgkddylicmekiyayagyiainisspntpg
    lrtlqygealddlltaiknkqndlqamhhkyvpiavkiapdlseeeliqvadslvrhnid
    gviatnttldrslvqgmkncdqtgglsgrplqlksteiirrlslelngrlpiigvggids
    viaarekiaagaslvqiysgfifkgpplikeivthi