Lineage for d1lrya_ (1lry A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264339Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 264340Superfamily d.167.1: Peptide deformylase [56420] (1 family) (S)
    nickel-dependent enzyme
  5. 264341Family d.167.1.1: Peptide deformylase [56421] (1 protein)
  6. 264342Protein Peptide deformylase [56422] (5 species)
  7. 264392Species Pseudomonas aeruginosa [TaxId:287] [75578] (1 PDB entry)
  8. 264393Domain d1lrya_: 1lry A: [74231]
    complexed with antibiotic actinonin
    complexed with bb2, zn

Details for d1lrya_

PDB Entry: 1lry (more details), 2.6 Å

PDB Description: Crystal Structure of P. aeruginosa Peptide Deformylase Complexed with Antibiotic Actinonin

SCOP Domain Sequences for d1lrya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrya_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa}
ailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivvm
dlsedkseprvfinpefepltedmdqyqegclsvpgfyenvdrpqkvrikaldrdgnpfe
evaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrq

SCOP Domain Coordinates for d1lrya_:

Click to download the PDB-style file with coordinates for d1lrya_.
(The format of our PDB-style files is described here.)

Timeline for d1lrya_: