Lineage for d1lrya_ (1lry A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.167: Peptide deformylase [56419] (1 superfamily) Superfamily d.167.1: Peptide deformylase [56420] (1 family) 
Family d.167.1.1: Peptide deformylase [56421] (1 protein) Protein Peptide deformylase [56422] (5 species) 
Species Pseudomonas aeruginosa [TaxId:287] [75578] (1 PDB entry) 
Domain d1lrya_: 1lry A: [74231]
Details for d1lrya_
PDB Entry: 1lry (more details), 2.6 Å
PDB Description: Crystal Structure of P. aeruginosa Peptide Deformylase Complexed with Antibiotic Actinonin
SCOP Domain Sequences for d1lrya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lrya_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa}
ailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivvm
dlsedkseprvfinpefepltedmdqyqegclsvpgfyenvdrpqkvrikaldrdgnpfe
evaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrq
SCOP Domain Coordinates for d1lrya_:
Click to download the PDB-style file with coordinates for d1lrya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lrya_:
- d1lrya_ is new in SCOP 1.61
- d1lrya_ appears in SCOP 1.63
- d1lrya_ appears in the current release, SCOPe 2.08
View in 3D