Lineage for d1lnua2 (1lnu A:1-83)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938303Species Mouse (Mus musculus), I-AB [TaxId:10090] [88815] (4 PDB entries)
  8. 2938305Domain d1lnua2: 1lnu A:1-83 [74098]
    Other proteins in same PDB: d1lnua1, d1lnub1, d1lnub2, d1lnuc1, d1lnud1, d1lnud2, d1lnue1, d1lnuf1, d1lnuf2, d1lnug1, d1lnuh1, d1lnuh2
    complexed with nag
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1lnua2

PDB Entry: 1lnu (more details), 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d1lnua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnua2 d.19.1.1 (A:1-83) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstpa

SCOPe Domain Coordinates for d1lnua2:

Click to download the PDB-style file with coordinates for d1lnua2.
(The format of our PDB-style files is described here.)

Timeline for d1lnua2: