Lineage for d1lnuc1 (1lnu C:84-182)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2349920Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2349986Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2349999Domain d1lnuc1: 1lnu C:84-182 [74101]
    Other proteins in same PDB: d1lnua2, d1lnub1, d1lnub2, d1lnuc2, d1lnud1, d1lnud2, d1lnue2, d1lnuf1, d1lnuf2, d1lnug2, d1lnuh1, d1lnuh2
    complexed with nag, ndg

Details for d1lnuc1

PDB Entry: 1lnu (more details), 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d1lnuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnuc1 b.1.1.2 (C:84-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnrd
ysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOPe Domain Coordinates for d1lnuc1:

Click to download the PDB-style file with coordinates for d1lnuc1.
(The format of our PDB-style files is described here.)

Timeline for d1lnuc1: