Lineage for d1lnud1 (1lnu D:121-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747484Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2747559Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2747566Domain d1lnud1: 1lnu D:121-217 [74103]
    Other proteins in same PDB: d1lnua1, d1lnua2, d1lnub2, d1lnuc1, d1lnuc2, d1lnud2, d1lnue1, d1lnue2, d1lnuf2, d1lnug1, d1lnug2, d1lnuh2
    contains covalently bound peptides at the N-termini of chains B, D, F and H
    complexed with nag

Details for d1lnud1

PDB Entry: 1lnu (more details), 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide
PDB Compounds: (D:) H-2 class II histocompatibility antigen, A beta chain

SCOPe Domain Sequences for d1lnud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnud1 b.1.1.2 (D:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewka

SCOPe Domain Coordinates for d1lnud1:

Click to download the PDB-style file with coordinates for d1lnud1.
(The format of our PDB-style files is described here.)

Timeline for d1lnud1: