Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d1lnua1: 1lnu A:84-182 [74097] Other proteins in same PDB: d1lnua2, d1lnub1, d1lnub2, d1lnuc2, d1lnud1, d1lnud2, d1lnue2, d1lnuf1, d1lnuf2, d1lnug2, d1lnuh1, d1lnuh2 complexed with nag |
PDB Entry: 1lnu (more details), 2.5 Å
SCOPe Domain Sequences for d1lnua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnua1 b.1.1.2 (A:84-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnrd ysfhklsyltfipsdddiydckvehwgleepvlkhwepe
Timeline for d1lnua1: