Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Mating type protein A1 Homeodomain [46693] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (6 PDB entries) |
Domain d1le8a_: 1le8 A: [73867] Other proteins in same PDB: d1le8b_ protein/DNA complex |
PDB Entry: 1le8 (more details), 2.3 Å
SCOPe Domain Sequences for d1le8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kssispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrsk
Timeline for d1le8a_: