Lineage for d1l9ze_ (1l9z E:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044682Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 3044683Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 3044684Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 3044852Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. 3044853Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)
  8. 3044875Domain d1l9ze_: 1l9z E: [73770]
    holoenzyme/fork-junction promoter DNA complex at 6.5 Angstrom resolution
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d1l9ze_

PDB Entry: 1l9z (more details), 6.5 Å

PDB Description: Thermus aquaticus RNA Polymerase Holoenzyme/Fork-Junction Promoter DNA Complex at 6.5 A Resolution
PDB Compounds: (E:) RNA polymerase, omega subunit

SCOPe Domain Sequences for d1l9ze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9ze_ i.8.1.1 (E:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
aepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpnav
twamkelltgrlffgenlvpedrlqkemerly

SCOPe Domain Coordinates for d1l9ze_:

Click to download the PDB-style file with coordinates for d1l9ze_.
(The format of our PDB-style files is described here.)

Timeline for d1l9ze_: