PDB entry 1l9z

View 1l9z on RCSB PDB site
Description: Thermus aquaticus RNA Polymerase Holoenzyme/Fork-Junction Promoter DNA Complex at 6.5 A Resolution
Class: transcription/DNA
Keywords: helix-turn-helix, coiled-coil, TRANSCRIPTION/DNA COMPLEX
Deposited on 2002-03-27, released 2002-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 6.5 Å
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase, alpha subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l9za_
  • Chain 'B':
    Compound: RNA polymerase, alpha subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l9zb_
  • Chain 'C':
    Compound: RNA polymerase, beta subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l9zc_
  • Chain 'D':
    Compound: RNA polymerase, beta-prime subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l9zd_
  • Chain 'E':
    Compound: RNA polymerase, omega subunit
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l9ze_
  • Chain 'H':
    Compound: sigma factor sigA
    Species: Thermus aquaticus [TaxId:271]
    Gene: rpoD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l9zh_
  • Chain 'T':
    Compound: template DNA strand
  • Chain 'U':
    Compound: nontemplate DNA strand
  • Heterogens: MG, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l9zA (A:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9zA (A:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadveimnp
    dlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtr
    lgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l9zB (B:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9zB (B:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadveimnp
    dlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtr
    lgqrtdldkltlriwtdgsvtplealnqavailkehlnyf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l9zC (C:)
    meikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkg
    kgglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlpl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasg
    vvtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlft
    llrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermv
    mgspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvt
    eevvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvf
    slntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevvkvdgtriavryedgrlvhplrryarsnqgtafdqrprvrvgqrvkkgdlladgpas
    eegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgper
    itrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifgek
    ardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdklan
    rhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqry
    ispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspee
    qlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqpl
    ggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpepsv
    pesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9zC (C:)
    eikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieeglvld
    fleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlplmtedgsf
    iingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasgvvtmkvn
    krkfplvlllrvlgydqetlvrelsglldeavlamrpeeamvrlftllrpglaylfglla
    dpkrydlgeagrykaeeklgvglsgrtlvfkdevflptlrylfaltagvpghevddidhl
    gnrrirtvgelmadqfrvglarlargvrermvmgspdtltpaklvnsrpleaalreffsr
    sqlsqfkdetnplsslrhkrrisalgpggltreragfdvrdvhrthygricpvetpegan
    iglitslaayarvdalgfirtpyrrvkngvvteevvymtaseedrytiaqantplegdri
    atdrvvarrrgepvivapeevefmdvspkqvfslntnlipflehddanralmgsnmqtqa
    vpliraqapvvmtgleervvrdslaalyaeedgevvkvdgtriavryedgrlvhplrrya
    rsnqgtafdqrprvrvgqrvdlladgpaseegflalgqnvlvaimpfdgynfedaivise
    ellkrdfytsihieryeieardtklgperitrdiphlseaalrdldeegivrigaevkpg
    dilvgrtsfkgeqepspeerllrsifgekardvkdtslrvppgeggivvgrlrlrrgdpg
    velkpgvrevvrvfvaqkrklqvgdklanrhgnkgvvakilpvedmphlpdgtpvdviln
    plgvpsrmnlgqilethlglagyflgqryispvfdgatepeikellaeafnlyfgkrqge
    gfgvdkrekevlaraeklglvspgkspeeqlkelfdlgkvvlydgrtgepfegpivvgqm
    fimklyhmvedkmharstgpyslitqqplggkaqfggqrfgemevwaleaygaahtlqem
    ltiksddiegrnaayqaiikgedvpepsvpesfrvlvkelqalaldvqtldekdnpvdif
    egla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1l9zD (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfnkyivldpkgavldgvpvekrqlltdeeyrelrygkqetyplpagvdalvk
    dgeevvkgqelapgvvsrmdgvalyrfprrvrvdylrkeraalriplsawvekeayrpge
    vlaelsepylfraeesgvvelkdlaeghliylrqeeevvaryflpagmtplvvegeivev
    gqplaegkgllrlprhmtakeveaeeegdsvhltlflewtepkdykvaphmnvivpegak
    vqagekivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevttgdrvapgdv
    ladggkvkseiygrvevdlvrnvvrvvesydidarmgaeaiqellkeldleklerellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgserpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvgrlk
    fvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaqeli
    qmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavipeek
    qryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkrsdi
    esglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtfhtggvavgtditqglprvi
    elfearrpkakaviseidgvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyve
    agqpltrgaidphqlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyve
    vtdpgdsrllegqvlekwdvealnerliaegkvpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqrtlkaieeark
    eaveakekeaprrpvrreqpgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9zD (D:)
    kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
    ykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsate
    leqvlyfnkyivldpkgavldgvpvekrqlltdeedarmgaeaiqellkeldleklerel
    leemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfat
    sdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgse
    rplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfl
    lkkmeekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafq
    pvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgep
    lakpsrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvg
    rlkfvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaq
    eliqmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavip
    eekqryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypf
    nplyvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshga
    rkggadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkr
    sdiesglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtr
    ygvcqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtprvielfearrpkakav
    iseidgvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpltrgaidph
    qlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpgdsrllegq
    vlekwdvealnerliavpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkk
    deliglkenvilgrlipagtgsdfvrftqvvdqrtlkaieear
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1l9zE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
    vtwamkelltgrlffgenlvpedrlqkemerlypteeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9zE (E:)
    aepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpnav
    twamkelltgrlffgenlvpedrlqkemerly
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1l9zH (H:)
    mkkskskkkaakaqevevkepvkepeplpeleaaedlqdlpepdpellasepeledladp
    ldlegpleadllpeeglleeeeeelslpkvstsdpvrqylheigqvplltleeeidlark
    veegmeaikklseatgldqelirevvrakilgtariqkipglkekpdpktveevdgklks
    lpkelkrylhiaregeaarqhlieanlrlvvsiakkytgrglsfldliqegnqglirave
    kfeykrrfkfstyatwwirqainraiadqartiripvhmvetinklsrtarqlqqelgre
    psyeeiaeamgpgwdakrveetlkiaqepvsletpigdekdsfygdfipdenlpspveaa
    aqsllseelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqienkal
    rklkyhesrtrklrdfle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9zH (H:)
    sdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakilg
    taevdgklkslpkelkrylhiaregeaarqhlieanlrlvvsiakkytgrglsfldliqe
    gnqgliravekfeykrrfkfstyatwwirqainraiadqartiripvhmvetinklsrta
    rqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsletpidfipdenlpspvea
    aaqsllseelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqienka
    lrklkyhesrtrklrdfle
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.