Lineage for d1l9zd_ (1l9z D:)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2595068Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 2595069Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 2595070Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 2595238Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. 2595239Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)
  8. 2595260Domain d1l9zd_: 1l9z D: [73769]
    holoenzyme/fork-junction promoter DNA complex at 6.5 Angstrom resolution
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d1l9zd_

PDB Entry: 1l9z (more details), 6.5 Å

PDB Description: Thermus aquaticus RNA Polymerase Holoenzyme/Fork-Junction Promoter DNA Complex at 6.5 A Resolution
PDB Compounds: (D:) RNA polymerase, beta-prime subunit

SCOPe Domain Sequences for d1l9zd_:

Sequence, based on SEQRES records: (download)

>d1l9zd_ i.8.1.1 (D:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
ykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsate
leqvlyfnkyivldpkgavldgvpvekrqlltdeeyrelrygkqetyplpagvdalvkdg
eevvkgqelapgvvsrmdgvalyrfprrvrvdylrkeraalriplsawvekeayrpgevl
aelsepylfraeesgvvelkdlaeghliylrqeeevvaryflpagmtplvvegeivevgq
plaegkgllrlprhmtakeveaeeegdsvhltlflewtepkdykvaphmnvivpegakvq
agekivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevttgdrvapgdvla
dggkvkseiygrvevdlvrnvvrvvesydidarmgaeaiqellkeldleklerelleemk
hpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlnd
lyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgserplrs
ltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkme
ekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlve
gqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakps
rdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvgrlkfv
fanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaqeliqm
dvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavipeekqr
yleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypfnplyv
maqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshgarkgga
dtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkrsdies
glygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtrygvcq
kcygydlsmarpvsigeavgvvaaesigepgtqltmrtfhtggvavgtditqglprviel
fearrpkakaviseidgvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyveag
qpltrgaidphqlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevt
dpgdsrllegqvlekwdvealnerliaegkvpvawkpllmgvtksalstkswlsaasfqn
tthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqrtlkaieear

Sequence, based on observed residues (ATOM records): (download)

>d1l9zd_ i.8.1.1 (D:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
ykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsate
leqvlyfnkyivldpkgavldgvpvekrqlltdeedarmgaeaiqellkeldleklerel
leemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfat
sdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgse
rplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfl
lkkmeekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafq
pvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgep
lakpsrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvg
rlkfvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaq
eliqmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavip
eekqryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypf
nplyvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshga
rkggadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkr
sdiesglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtr
ygvcqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtprvielfearrpkakav
iseidgvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpltrgaidph
qlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpgdsrllegq
vlekwdvealnerliavpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkk
deliglkenvilgrlipagtgsdfvrftqvvdqrtlkaieear

SCOPe Domain Coordinates for d1l9zd_:

Click to download the PDB-style file with coordinates for d1l9zd_.
(The format of our PDB-style files is described here.)

Timeline for d1l9zd_: