Lineage for d1l8ab2 (1l8a B:471-700)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242757Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 242758Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
    both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold
    conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules
  5. 242840Family c.36.1.2: TK-like THDP-binding domains [52528] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 242841Protein Pyruvate dehydrogenase E1 component, PP and Pyr modules [75185] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 242842Species Escherichia coli [TaxId:562] [75186] (1 PDB entry)
  8. 242846Domain d1l8ab2: 1l8a B:471-700 [73681]
    Other proteins in same PDB: d1l8aa3, d1l8ab3
    complexed with mg, tdp

Details for d1l8ab2

PDB Entry: 1l8a (more details), 1.85 Å

PDB Description: e. coli pyruvate dehydrogenase

SCOP Domain Sequences for d1l8ab2:

Sequence, based on SEQRES records: (download)

>d1l8ab2 c.36.1.2 (B:471-700) Pyruvate dehydrogenase E1 component, PP and Pyr modules {Escherichia coli}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl
pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl
tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa

Sequence, based on observed residues (ATOM records): (download)

>d1l8ab2 c.36.1.2 (B:471-700) Pyruvate dehydrogenase E1 component, PP and Pyr modules {Escherichia coli}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri
gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva
vimhdglermygekqenvyyyittlnenyhmpa

SCOP Domain Coordinates for d1l8ab2:

Click to download the PDB-style file with coordinates for d1l8ab2.
(The format of our PDB-style files is described here.)

Timeline for d1l8ab2: