Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules |
Family c.36.1.2: TK-like THDP-binding domains [52528] (2 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
Protein Pyruvate dehydrogenase E1 component, PP and Pyr modules [75185] (1 species) E1A and E1B fused together in a single-chain protein |
Species Escherichia coli [TaxId:562] [75186] (1 PDB entry) |
Domain d1l8ab2: 1l8a B:471-700 [73681] Other proteins in same PDB: d1l8aa3, d1l8ab3 complexed with mg, tdp |
PDB Entry: 1l8a (more details), 1.85 Å
SCOP Domain Sequences for d1l8ab2:
Sequence, based on SEQRES records: (download)
>d1l8ab2 c.36.1.2 (B:471-700) Pyruvate dehydrogenase E1 component, PP and Pyr modules {Escherichia coli} eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa
>d1l8ab2 c.36.1.2 (B:471-700) Pyruvate dehydrogenase E1 component, PP and Pyr modules {Escherichia coli} eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva vimhdglermygekqenvyyyittlnenyhmpa
Timeline for d1l8ab2: