SCOPe 2.05: Domain d1l3eb_: 1l3e B:

Lineage for d1l3eb_ (1l3e B:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.53: TAZ domain [57932] (1 superfamily)
   all-alpha fold; Zn-binding sites are in the loops connecting helices

4. Superfamily g.53.1: TAZ domain [57933] (1 family)
   automatically mapped to Pfam PF02135

5. Family g.53.1.1: TAZ domain [57934] (2 proteins)

6. Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75696] (3 PDB entries)

8. Domain d1l3eb_: 1l3e B: [73536]
   Other proteins in same PDB: d1l3ea_
   CH1 (TAZ1) domain; complexed with the C-terminal activation domain (CTAD) of human HIF-1alpha (chain A)
   complexed with zn

Details for d1l3eb_

PDB Entry: 1l3e

PDB Description: nmr structures of the hif-1alpha ctad/p300 ch1 complex

PDB Compounds: (B:) p300 protein

SCOPe Domain Sequences for d1l3eb_:

Sequence; same for both SEQRES and ATOM records:

>d1l3eb_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Human (Homo sapiens) [TaxId: 9606]}
mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc
qsgkscqvahcassrqiishwknctrhdcpvclplknagdk

Timeline for d1l3eb_:

• d1l3eb_ first appeared in SCOP 1.61
  
• d1l3eb_ appears in SCOPe 2.04
  
• d1l3eb_ appears in SCOPe 2.06
  
• d1l3eb_ appears in the current release, SCOPe 2.08