Lineage for d1l3eb_ (1l3e B:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 205332Fold g.53: TAZ domain [57932] (1 superfamily)
  4. 205333Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
  5. 205334Family g.53.1.1: TAZ domain [57934] (1 protein)
  6. 205335Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)
  7. 205336Species Human (Homo sapiens) [TaxId:9606] [75696] (1 PDB entry)
  8. 205337Domain d1l3eb_: 1l3e B: [73536]
    Other proteins in same PDB: d1l3ea_

Details for d1l3eb_

PDB Entry: 1l3e (more details)

PDB Description: nmr structures of the hif-1alpha ctad/p300 ch1 complex

SCOP Domain Sequences for d1l3eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3eb_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Human (Homo sapiens)}
mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc
qsgkscqvahcassrqiishwknctrhdcpvclplknagdk

SCOP Domain Coordinates for d1l3eb_:

Click to download the PDB-style file with coordinates for d1l3eb_.
(The format of our PDB-style files is described here.)

Timeline for d1l3eb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1l3ea_