Lineage for d1l3eb_ (1l3e B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264747Fold g.53: TAZ domain [57932] (1 superfamily)
    all-alpha fold; Zn-binding sites are in the loops connecting helices
  4. 2264748Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
    automatically mapped to Pfam PF02135
  5. 2264749Family g.53.1.1: TAZ domain [57934] (2 proteins)
  6. 2264750Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)
  7. 2264751Species Human (Homo sapiens) [TaxId:9606] [75696] (3 PDB entries)
  8. 2264753Domain d1l3eb_: 1l3e B: [73536]
    Other proteins in same PDB: d1l3ea1, d1l3ea2
    CH1 (TAZ1) domain; complexed with the C-terminal activation domain (CTAD) of human HIF-1alpha (chain A)
    complexed with zn

Details for d1l3eb_

PDB Entry: 1l3e (more details)

PDB Description: nmr structures of the hif-1alpha ctad/p300 ch1 complex
PDB Compounds: (B:) p300 protein

SCOPe Domain Sequences for d1l3eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3eb_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Human (Homo sapiens) [TaxId: 9606]}
mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc
qsgkscqvahcassrqiishwknctrhdcpvclplknagdk

SCOPe Domain Coordinates for d1l3eb_:

Click to download the PDB-style file with coordinates for d1l3eb_.
(The format of our PDB-style files is described here.)

Timeline for d1l3eb_: