PDB entry 1l3e

View 1l3e on RCSB PDB site
Description: NMR Structures of the HIF-1alpha CTAD/p300 CH1 Complex
Class: transcription
Keywords: protein-protein complex, transcription
Deposited on 2002-02-26, released 2002-04-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypoxia inducible factor-1 alpha subunit
  Species: Homo sapiens [TaxId:9606]
  Gene: hypoxia inducible factor-1 alpha
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q16665 (0-41)
    • cloning artifact (0)
  Domains in SCOPe 2.05: d1l3ea_
• Chain 'B':
  Compound: p300 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: p300
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q09472 (0-100)
  Domains in SCOPe 2.05: d1l3eb_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l3eA (A:)
  gsmdesglpqltsydcevnapiqgsrnllqgeellraldqvn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l3eB (B:)
  mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc
  qsgkscqvahcassrqiishwknctrhdcpvclplknagdk