SCOPe 2.05: Domain d1l3ea_: 1l3e A:

Lineage for d1l3ea_ (1l3e A:)

1. Root: SCOPe 2.05

2. Class j: Peptides [58231] (129 folds)

3. Fold j.96: Transactivation domain [81275] (1 superfamily)

4. Superfamily j.96.1: Transactivation domain [74800] (1 family)

5. Family j.96.1.1: Transactivation domain [74801] (2 proteins)

6. Protein C-terminal activation domain (CTAD) of HIF-1alpha [74802] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74803] (4 PDB entries)

8. Domain d1l3ea_: 1l3e A: [73535]
   Other proteins in same PDB: d1l3eb_
   complexed with TAZ1 domain of human CBP
   complexed with zn

Details for d1l3ea_

PDB Entry: 1l3e

PDB Description: nmr structures of the hif-1alpha ctad/p300 ch1 complex

PDB Compounds: (A:) hypoxia inducible factor-1 alpha subunit

SCOPe Domain Sequences for d1l3ea_:

Sequence; same for both SEQRES and ATOM records:

>d1l3ea_ j.96.1.1 (A:) C-terminal activation domain (CTAD) of HIF-1alpha {Human (Homo sapiens) [TaxId: 9606]}
gsmdesglpqltsydcevnapiqgsrnllqgeellraldqvn

Timeline for d1l3ea_:

• d1l3ea_ first appeared in SCOP 1.61
  
• d1l3ea_ appears in SCOPe 2.04
  
• d1l3ea_ is called d1l3ea1 in SCOPe 2.06
  
• d1l3ea_ appears in the current release, SCOPe 2.08, called d1l3ea1