Lineage for d1kv3e4 (1kv3 E:146-468)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927111Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 2927117Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 2927155Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [75333] (5 PDB entries)
    GDP-binding protein
  8. 2927167Domain d1kv3e4: 1kv3 E:146-468 [73046]
    Other proteins in same PDB: d1kv3a1, d1kv3a2, d1kv3a3, d1kv3b1, d1kv3b2, d1kv3b3, d1kv3c1, d1kv3c2, d1kv3c3, d1kv3d1, d1kv3d2, d1kv3d3, d1kv3e1, d1kv3e2, d1kv3e3, d1kv3f1, d1kv3f2, d1kv3f3
    complexed with gdp

Details for d1kv3e4

PDB Entry: 1kv3 (more details), 2.8 Å

PDB Description: human tissue transglutaminase in gdp bound form
PDB Compounds: (E:) protein-glutamine gamma-glutamyltransferase

SCOPe Domain Sequences for d1kv3e4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kv3e4 d.3.1.4 (E:146-468) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfqdgildiclilldvnpkflk
nagrdcsrrsspvyvgrvgsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk
nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg
dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdls
tkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtyky
pegsseereaftranhlnklaek

SCOPe Domain Coordinates for d1kv3e4:

Click to download the PDB-style file with coordinates for d1kv3e4.
(The format of our PDB-style files is described here.)

Timeline for d1kv3e4: