![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
![]() | Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
![]() | Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (5 PDB entries) GDP-binding protein |
![]() | Domain d1kv3e1: 1kv3 E:15-145 [73043] Other proteins in same PDB: d1kv3a2, d1kv3a3, d1kv3a4, d1kv3b2, d1kv3b3, d1kv3b4, d1kv3c2, d1kv3c3, d1kv3c4, d1kv3d2, d1kv3d3, d1kv3d4, d1kv3e2, d1kv3e3, d1kv3e4, d1kv3f2, d1kv3f3, d1kv3f4 complexed with gdp |
PDB Entry: 1kv3 (more details), 2.8 Å
SCOPe Domain Sequences for d1kv3e1:
Sequence, based on SEQRES records: (download)
>d1kv3e1 b.1.18.9 (E:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} etngrdhhtadlcreklvvrrgqpfwltlhfegrnyqasvdsltfsvvtgpapsqeagtk arfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleastgyqgssfvlgh fillfnawcpa
>d1kv3e1 b.1.18.9 (E:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} etngrdhhtadlcreklvvrrgqpfwltlsltfsvvtgpapsqeagtkarfplrdaveeg dwtatvvdqqdctlslqlttpanapiglyrlsleasghfillfnawcpa
Timeline for d1kv3e1: