![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) ![]() |
![]() | Family b.77.3.1: Mannose-binding lectins [51102] (4 proteins) |
![]() | Protein Jacalin [51103] (1 species) |
![]() | Species Jackfruit (Artocarpus integrifolia) [51104] (4 PDB entries) |
![]() | Domain d1kuj.1: 1kuj B:,A: [73010] |
PDB Entry: 1kuj (more details), 2 Å
SCOP Domain Sequences for d1kuj.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1kuj.1 b.77.3.1 (B:,A:) Jacalin {Jackfruit (Artocarpus integrifolia)} eqsgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgq nhksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgt pfnlpienglivgfkgsigywldyfsmylsl
Timeline for d1kuj.1: